PDB entry 1ujp

View 1ujp on RCSB PDB site
Description: Crystal Structure of Tryptophan Synthase A-Subunit From Thermus thermophilus HB8
Class: Lyase
Keywords: Tryptophan Synthase, Tryptophan, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, Lyase
Deposited on 2003-08-08, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.203
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ujpa_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujpA (A:)
    mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdplgdgp
    viqraselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqaga
    tgvilpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvtgvt
    gmrerlpeevkdlvrrikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegr
    slapllqeirqglqrleanpglkesskkplp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujpA (A:)
    mttleafakarsegraalipyltagfpsregflqaveevlpyadlleiglpysdgpviqr
    aselalrkgmsvqgalelvrevraltekplflmtylnpvlawgperffglfkqagatgvi
    lpdlppdedpglvrlaqeigletvfllaptstdariatvvrhatgfvyavsvevkdlvrr
    ikartalpvavgfgvsgkataaqaavadgvvvgsalvraleegrslapllqeirqglqrl
    plp