PDB entry 1ujo

View 1ujo on RCSB PDB site
Description: Solution Structure of the CH domain from Mouse Trangelin
Class: structural protein
Keywords: transgelin, CH domain, actin binding, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2003-08-08, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transgelin
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 0610041C11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37804 (7-137)
      • cloning artifact (0-6)
      • cloning artifact (138-143)
    Domains in SCOPe 2.08: d1ujoa1, d1ujoa2, d1ujoa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujoA (A:)
    gssgssgeeleerlvewivvqcgpdvgrpdrgrlgfqvwlkngvilsklvnslypegskp
    vkvpenppsmvfkqmeqvaqflkaaedygviktdmfqtvdlyegkdmaavqrtlmalgsl
    avtkndgnyrgdpnwfmksgpssg