PDB entry 1ujn

View 1ujn on RCSB PDB site
Description: Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8
Deposited on 2003-08-06, released 2003-09-02
The last revision prior to the SCOP 1.69 freeze date was dated 2003-09-16, with a file datestamp of 2003-09-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ujna_
  • Chain 'B':
    Domains in SCOP 1.69: d1ujnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujnA (A:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
    dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujnA (A:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylsl
    hwvvplapgrlvvrplpegllreafaawreelkglgll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujnB (B:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
    dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujnB (B:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    alphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylslhwv
    vplapgrlvvrplpegllreafaawreelkglgllr