PDB entry 1ujn

View 1ujn on RCSB PDB site
Description: Crystal structure of dehydroquinate synthase from Thermus thermophilus HB8
Class: lyase
Keywords: dehydroquinate synthase, Thermus thermophilus, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, LYASE
Deposited on 2003-08-06, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dehydroquinate synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujna_
  • Chain 'B':
    Compound: dehydroquinate synthase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujnA (A:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
    dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujnA (A:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylsl
    hwvvplapgrlvvrplpegllreafaawreelkglgll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujnB (B:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    trhalphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpyllr
    dkkkvseslhwvvplapgrlvvrplpegllreafaawreelkglgllr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujnB (B:)
    mqrlevrepvpypilvgegvlkevpplagpaallfdrrvegfaqevakalgvrhllglpg
    geaakslevygkvlswlaekglprnatllvvgggtltdlggfvaatylrgvaylafpttt
    laivdasvggktginlpegknlvgafhfpqgvyaelralktlplptfkeglveafkhgli
    agdeallkvedltpqsprleaflaravavkvrvteedplekgkrrllnlghtlghaleaq
    alphgmavaygllyaallgralggedllppvrrlllwlsppplpplafedllpylslhwv
    vplapgrlvvrplpegllreafaawreelkglgllr