PDB entry 1ujm

View 1ujm on RCSB PDB site
Description: Crystal structure of aldehyde reductase 2 from Sporobolomyces salmonicolor AKU4429
Deposited on 2003-08-06, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ujma_
  • Chain 'B':
    Domains in SCOP 1.71: d1ujmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujmA (A:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujmB (B:)
    akidnavlpegslvlvtgangfvashvveqllehgykvrgtarsasklanlqkrwdakyp
    grfetavvedmlkqgaydevikgaagvahiasvvsfsnkydevvtpaiggtlnalraaaa
    tpsvkrfvltsstvsalipkpnvegiyldekswnlesidkaktlpesdpqkslwvyaask
    teaelaawkfmdenkphftlnavlpnytigtifdpetqsgstsgwmmslfngevspalal
    mppqyyvsavdigllhlgclvlpqierrrvygtagtfdwntvlatfrklypsktfpadfp
    dqgqdlskfdtapsleilkslgrpgwrsieesikdlvgseta