PDB entry 1ujl

View 1ujl on RCSB PDB site
Description: Solution Structure of the HERG K+ channel S5-P extracellular linker
Class: membrane protein
Keywords: two helices, amphiphatic helix, MEMBRANE PROTEIN
Deposited on 2003-08-05, released 2003-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Potassium voltage-gated channel subfamily H member 2
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12809 (0-41)
  Domains in SCOPe 2.08: d1ujla_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ujlA (A:)
  aignmeqphmdsrigwlhnlgdqigkpynssglggpsikdky