PDB entry 1ujk

View 1ujk on RCSB PDB site
Description: VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
Deposited on 2003-08-05, released 2004-05-11
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ujka_
  • Chain 'B':
    Domains in SCOP 1.67: d1ujkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujkA (A:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujkA (A:)
    epamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqew
    eaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellys
    wtvglpeevkiaeayqmlkkqgivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujkB (B:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujkB (B:)
    petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
    ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
    peevkiaeayqmlkkqgivk