PDB entry 1ujk

View 1ujk on RCSB PDB site
Description: VHS domain of human GGA1 complexed with C-terminal phosphopeptide from BACE
Class: PROTEIN TRANSPORT/Hydrolase
Keywords: PROTEIN-PEPTIDE COMPLEX, PROTEIN TRANSPORT, ADAPTOR PROTEIN, PROTEIN TRANSPORT/Hydrolase COMPLEX
Deposited on 2003-08-05, released 2004-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ujka_
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ujkb_
  • Chain 'C':
    Compound: C-terminal peptide from Beta-secretase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (Start-11)
      • modified residue (8)
  • Chain 'D':
    Compound: C-terminal peptide from Beta-secretase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (Start-11)
      • modified residue (8)
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujkA (A:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujkA (A:)
    epamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqew
    eaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellys
    wtvglpeevkiaeayqmlkkqgivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujkB (B:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujkB (B:)
    petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
    ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
    peevkiaeayqmlkkqgivk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.