PDB entry 1ujj

View 1ujj on RCSB PDB site
Description: VHS domain of human GGA1 complexed with C-terminal peptide from BACE
Class: PROTEIN TRANSPORT/Hydrolase
Keywords: PROTEIN-PEPTIDE COMPLEX, PROTEIN TRANSPORT, ADAPTOR PROTEIN, PROTEIN TRANSPORT/Hydrolase COMPLEX
Deposited on 2003-08-05, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.244
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujja_
  • Chain 'B':
    Compound: ADP-ribosylation factor binding protein GGA1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ujjb_
  • Chain 'C':
    Compound: C-terminal peptide from Beta-secretase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ujjA (A:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujjA (A:)
    petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
    ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
    peevkiaeayqmlkkqgivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ujjB (B:)
    mepamepetlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqe
    weaiqaltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilelly
    swtvglpeevkiaeayqmlkkqgivks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ujjB (B:)
    petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
    ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
    peevkiaeayqmlkkqgivk
    

  • Chain 'C':
    No sequence available.