PDB entry 1ujd

View 1ujd on RCSB PDB site
Description: Solution Structure of RSGI RUH-003, a PDZ domain of hypothetical KIAA0559 protein from human cDNA
Class: structural genomics, unknown function
Keywords: PDZ domain, structural genomics, human cdna, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-07-31, released 2004-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0559 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y6V0 (7-110)
      • cloning artifact (0-6)
      • cloning artifact (111-116)
    Domains in SCOPe 2.07: d1ujda1, d1ujda2, d1ujda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ujdA (A:)
    gssgssghyifpharikitrdskdhtvsgnglgirivggkeipghsgeigayiakilpgg
    saeqtgklmegmqvlewngipltsktyeevqsiisqqsgeaeicvrldlnmsgpssg