PDB entry 1ujc

View 1ujc on RCSB PDB site
Description: Structure of the protein histidine phosphatase SixA complexed with tungstate
Deposited on 2003-07-31, released 2005-01-25
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphohistidine phosphatase sixA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, WO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ujcA (A:)
    mqvfimrhgdaaldaasdsvrplttngcdesrlmanwlkgqkveiervlvspflraeqtl
    eevgdclnlpssaevlpeltpcgdvglvsaylqaltnegvasvlvishlplvgylvaelc
    pgetppmfttsaiasvtldesgngtfnwqmspcnlkmakai
    

    Sequence, based on observed residues (ATOM records):
    >1ujcA (A:)
    mqvfimrhgdaaldaasdsvrplttngcdesrlmanwlkgqkveiervlvspflraeqtl
    eevgdclnlpssaevlpeltpcgdvglvsaylqaltnegvasvlvishlplvgylvaelc
    pgetppmfttsaiasvtldesgngtfnwqmspcnlk