PDB entry 1uj8

View 1uj8 on RCSB PDB site
Description: Structures of ORF3 in Two Crystal Forms, a Member of Isc Machinery of E. coli Involved in the Assembly of Iron-Sulfur Clusters
Class: structural genomics, unknown function
Keywords: iron-sulfur cluster, isc, structural genomics, unknown function
Deposited on 2003-07-29, released 2005-02-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.194
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein yfhJ
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C0L9 (12-End)
    • expression tag (3-11)
  Domains in SCOPe 2.08: d1uj8a1, d1uj8a2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1uj8A (A:)
  mrgshhhhhhgsglkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqas
  nekileaillvwldeae
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1uj8A (A:)
  shhhhhhgsglkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnek
  ileaillvwldea