PDB entry 1uj4

View 1uj4 on RCSB PDB site
Description: Crystal structure of Thermus thermophilus ribose-5-phosphate isomerase
Class: isomerase
Keywords: alpha-beta fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-07-26, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribose 5-phosphate isomerase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uj4a1, d1uj4a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uj4A (A:)
    merplesykkeaahaaiayvqdgmvvglgtgstaryavlelarrlregelkgvvgvptsr
    ateelakregiplvdlppegvdlaidgadeiapglalikgmggallrekivervakefiv
    iadhtkkvpvlgrgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadc
    rfgpigdplglhralleipgvvetglfvgmatralvagpfgveellp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj4A (A:)
    rplesykkeaahaaiayvqdgmvvglgtgstaryavlelarrlregelkgvvgvptsrat
    eelakregiplvdlppegvdlaidgadeiapglalikgmggallrekivervakefivia
    dhtkkvpvlgrgpvpveivpfgyratlkaiadlggepelrmdgdefyftdgghliadcrf
    gpigdplglhralleipgvvetglfvgmatralvagpfgveellp