PDB entry 1uj3

View 1uj3 on RCSB PDB site
Description: Crystal structure of a humanized Fab fragment of anti-tissue-factor antibody in complex with tissue factor
Class: immune system/blood clotting
Keywords: tissue factor, antigen, antibody, Fab
Deposited on 2003-07-25, released 2004-07-25
The last revision prior to the SCOP 1.73 freeze date was dated 2004-07-25, with a file datestamp of 2007-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: -1.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IgG Fab light chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1uj3a1, d1uj3a2
  • Chain 'B':
    Compound: IgG Fab heavy chain
    Species: HOMO SAPIENS
    Domains in SCOP 1.73: d1uj3b1, d1uj3b2
  • Chain 'C':
    Compound: tissue factor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1uj3c1, d1uj3c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uj3A (A:)
    diqmtqspsslsasvgdrvtitckasqdiksflswyqqkpekapksliyyatsladgvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgect
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj3A (A:)
    diqmtqspsslsasvgdrvtitckasqdiksflswyqqkpekapksliyyatsladgvps
    rfsgsgsgtdytltisslqpedfatyyclqhgespytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uj3B (B:)
    qvqllesgavlarpgtsvkisckasgfnikdyymhwvkqrpgqglewiggndpanghsmy
    dpkfqgrvtitadtststvfmelsslrsedtavyycardsgyamdywgqgtlvtvssast
    kgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtktytcnvdhkpsntkvdkrves
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uj3C (C:)
    tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
    dvkqtylarvfsypagnvestgsageplyenspeftpyletnlgqptiqsfeqvgtkvnv
    tvedertlvrrnntflslrdvfgkdliytlyywkssssgkktaktntneflidvdkgeny
    cfsvqavipsrtvnrkstdspvecm