PDB entry 1uj2

View 1uj2 on RCSB PDB site
Description: Crystal structure of human uridine-cytidine kinase 2 complexed with products, CMP and ADP
Class: transferase
Keywords: ALPHA/BETA MONONUCLEOTIDE-BINDING HOLD, transferase
Deposited on 2003-07-25, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.19
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uj2a_
  • Chain 'B':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uj2b_
  • Heterogens: MG, C5P, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uj2A (A:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj2A (A:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uj2B (B:)
    pgmagdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvi
    lsqdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshs
    rkeetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdl
    eqilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqt
    ngclngytpsrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj2B (B:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng