PDB entry 1uj0

View 1uj0 on RCSB PDB site
Description: Crystal Structure of STAM2 SH3 domain in complex with a UBPY-derived peptide
Deposited on 2003-07-24, released 2003-12-23
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uj0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uj0A (A:)
    aghmarrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttd
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj0A (A:)
    marrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttdl