PDB entry 1uj0

View 1uj0 on RCSB PDB site
Description: Crystal Structure of STAM2 SH3 domain in complex with a UBPY-derived peptide
Class: signaling protein/signaling protein
Keywords: STAM, SH3, deubiquitinating enzyme, Grb2, Gads, PXXP, Hrs, endocytosis, early endosome, SIGNALING PROTEIN/SIGNALING PROTEIN COMPLEX
Deposited on 2003-07-24, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.216
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88811 (4-End)
      • cloning artifact (3)
    Domains in SCOPe 2.07: d1uj0a1, d1uj0a2
  • Chain 'B':
    Compound: deubiquitinating enzyme UBPY
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • GB BAB18534 (0-End)
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uj0A (A:)
    aghmarrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttd
    ls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uj0A (A:)
    marrvralydfeavedneltfkhgelitvlddsdanwwqgenhrgtglfpsnfvttdl
    

  • Chain 'B':
    No sequence available.