PDB entry 1uiz

View 1uiz on RCSB PDB site
Description: Crystal Structure Of Macrophage Migration Inhibitory Factor From Xenopus Laevis.
Class: cytokine
Keywords: Cytokine, Tautomerase, Macrophage Migration Inhibitory Factor, MIF
Deposited on 2003-07-24, released 2004-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • GB BAD02463 (0-114)
    Domains in SCOPe 2.08: d1uiza_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • GB BAD02463 (0-114)
    Domains in SCOPe 2.08: d1uizb_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • GB BAD02463 (0-114)
    Domains in SCOPe 2.08: d1uizc_
  • Chain 'D':
    Compound: macrophage migration inhibitory factor
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • GB BAD02463 (0-114)
    Domains in SCOPe 2.08: d1uizd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uizA (A:)
    mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
    slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uizB (B:)
    mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
    slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uizC (C:)
    mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
    slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uizD (D:)
    mpvftirtnvcrdsvpdtllsdltkqlakatgkpaeyiaihivpdqimsfgdstdpcavc
    slcsigkiggpqnksytkllcdiltkqlnipanrvyinyydlnaanvgwngstfa