PDB entry 1uiy

View 1uiy on RCSB PDB site
Description: crystal structure of enoyl-coa hydratase from thermus thermophilus hb8
Deposited on 2003-07-24, released 2003-08-05
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.204
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uiya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uiyA (A:)
    mvqvekghvavvflndperrnplspemalsllqalddleadpgvravvltgrgkafsaga
    dlaflervtelgaeenyrhslslmrlfhrvytypkptvaavngpavaggaglalacdlvv
    mdeearlgytevkigfvaalvsvilvravgekaakdllltgrlveareakalglvnriap
    pgkaleeakalaeevaknaptslrltkelllalpgmgledgfrlaalanawvretgdlae
    giraffekrpprf