PDB entry 1uiu

View 1uiu on RCSB PDB site
Description: Crystal structures of the liganded and unliganded nickel binding protein NikA from Escherichia coli (Nickel unliganded form)
Class: metal transport
Keywords: Nickel binding protein, Nickel unliganded form, Crytsal structure, METAL TRANSPORT
Deposited on 2003-07-22, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33590
      • engineered (360)
    Domains in SCOPe 2.07: d1uiua_
  • Chain 'B':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33590
      • engineered (360)
    Domains in SCOPe 2.07: d1uiub_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uiuA (A:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    radmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiuA (A:)
    deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
    tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
    sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
    ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
    qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
    glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
    mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
    gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
    pyapiateipfeqikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uiuB (B:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    radmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiuB (B:)
    deittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgktw
    tftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitlk
    sayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrnen
    ywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtqls
    qpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyanl
    glkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiirad
    mrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaqq
    gladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgni
    pyapiateipfeqikp