PDB entry 1uit

View 1uit on RCSB PDB site
Description: solution structure of rsgi ruh-006, the third pdz domain of hdlg5 (kiaa0583) protein [homo sapiens]
Deposited on 2003-07-22, released 2004-01-22
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-22, with a file datestamp of 2004-01-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uita_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uitA (A:)
    gssgssggerrkdrpyveeprhvkvqkgseplgisivsgekggiyvskvtvgsiahqagl
    eygdqllefnginlrsateqqarliigqqcdtitilaqynphvhqlsshsrsgpssg