PDB entry 1uir

View 1uir on RCSB PDB site
Description: Crystal Structure of Polyamine Aminopropyltransfease from Thermus thermophilus
Class: transferase
Keywords: Spermidien Synthase, Spermine Synthase, Polyamine, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, transferase
Deposited on 2003-07-18, released 2003-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyamine Aminopropyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uira_
  • Chain 'B':
    Compound: Polyamine Aminopropyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uirb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uirA (A:)
    mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
    yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
    mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
    vkahlnpggvmgmqtgmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
    dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
    vtpegearqapykg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uirA (A:)
    mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
    yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
    mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
    vkahlnpggvmgmqtgmillrvhpvvhrtvreafryvrsyknhipgfflnfgfllasdaf
    dpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfyvtp
    egearqapy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uirB (B:)
    mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
    yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
    mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
    vkahlnpggvmgmqtgmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
    dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
    vtpegearqapykg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uirB (B:)
    mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterde
    yiyhetlvhpamlthpepkrvlivgggegatlrevlkhptvekavmvdidgelvevakrh
    mpewhqgafddpravlviddaraylerteerydvviidltdpvgednparllytvefyrl
    vkahlnpggvmgmqtgmillthhrvhpvvhrtvreafryvrsyknhipgfflnfgfllas
    dafdpaafsegviearirernlalrhltapyleamfvlpkdllealeketmvstdqnpfy
    vtpegearqapyk