PDB entry 1uip

View 1uip on RCSB PDB site
Description: adenosine deaminase (his 238 glu mutant)
Deposited on 1996-08-30, released 1997-06-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-24, with a file datestamp of 1997-06-25.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1uip__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uip_ (-)
    tpafnkpkvelhvhldgaikpetilyfgkkrgialpadtveelrniigmdkplslpgfla
    kfdyympviagcreaikriayefvemkakegvvyvevrysphllanskvdpmpwnqtegd
    vtpddvvdlvnqglqegeqafgikvrsilccmrhqpswslevlelckkynqktvvamdla
    gdetiegsslfpghveayegavkngihrtvhagevgspevvreavdilktervgegyhti
    edealynrllkenmhfevcpwssyltgawdpktthavvrfkndkanyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpeeekkellerlyreyq