PDB entry 1uin

View 1uin on RCSB PDB site
Description: Crystal Structure of Threonine Synthase from Thermus Thermophilus HB8, Trigonal Crystal Form
Deposited on 2003-07-17, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uina_
  • Chain 'B':
    Domains in SCOP 1.67: d1uinb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uinA (A:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uinA (A:)
    rpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfk
    drgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqsl
    vhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphy
    halpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatai
    rignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkll
    regrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uinB (B:)
    mrpplieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsf
    kdrgmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagyvalgkvaqs
    lvhgarivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaph
    yhalpvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlata
    irignpaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkl
    lregrlepestvvltltghglkdpataervaelpppvparleavaaaagll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uinB (B:)
    plieryrnllpvsektpvisllegstpliplkgpeearkkgirlyakyeglnptgsfkdr
    gmtlavskaveggaqavacastgntaasaaayaaragilaivvlpagvalgkvaqslvhg
    arivqvegnfddalrltqklteafpvalvnsvnphrlegqktlafevvdelgdaphyhal
    pvgnagnitahwmgykayhalgkakrlprmlgfqaagaaplvlgrpverpetlatairig
    npaswqgavrakeesggvieavtdeeilfayrylareegifcepasaaamagvfkllreg
    rlepestvvltltghglkdpataervaelpppvparleavaaaagl