PDB entry 1uil

View 1uil on RCSB PDB site
Description: double-stranded rna-binding motif of hypothetical protein bab28848
Deposited on 2003-07-17, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1uila_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uilA (A:)
  gssgssgleseevdlnaglhgnwtlenakarlnqyfqkekiqgeykytqvgpdhnrsfia
  emtiyikqlgrrifarehgsnkklaaqscalslvrqlyhlgvieayssgpssg