PDB entry 1uik

View 1uik on RCSB PDB site
Description: Crystal structure of soybean beta-conglycinin alpha prime homotrimer
Class: sugar binding protein
Keywords: double-stranded beta-helix, SUGAR BINDING PROTEIN
Deposited on 2003-07-16, released 2004-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha prime subunit of beta-conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uika1, d1uika2
  • Chain 'B':
    Compound: alpha prime subunit of beta-conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uikb1, d1uikb2
  • Chain 'C':
    Compound: alpha prime subunit of beta-conglycinin
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uikc1, d1uikc2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uikA (A:)
    rrhknknpfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlll
    phhadadylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmi
    tlaipvnkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqg
    eerlqesviveiskkqirelskhaksssrktissedkpfnlrsrdpiysnklgklfeitp
    eknpqlrdldvflsvvdmnegalflphfnskaivvlvinegeanielvgikeqqqrqqqe
    eqplevrkyraelseqdifvipagypvvvnatsdlnffafginaennqrnflagskdnvi
    sqipsqvqelafpgsakdienliksqsesyfvdaqpqqkeegnkgrkgplssilrafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uikA (A:)
    npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
    dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
    nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
    elskhaksssrktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdm
    negalflphfnskaivvlvinegeanielvgiplevrkyraelseqdifvipagypvvvn
    atsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesy
    fvda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uikB (B:)
    rrhknknpfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlll
    phhadadylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmi
    tlaipvnkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqg
    eerlqesviveiskkqirelskhaksssrktissedkpfnlrsrdpiysnklgklfeitp
    eknpqlrdldvflsvvdmnegalflphfnskaivvlvinegeanielvgikeqqqrqqqe
    eqplevrkyraelseqdifvipagypvvvnatsdlnffafginaennqrnflagskdnvi
    sqipsqvqelafpgsakdienliksqsesyfvdaqpqqkeegnkgrkgplssilrafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uikB (B:)
    npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
    dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
    nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
    elskhaksssrktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdm
    negalflphfnskaivvlvinegeanielvgilevrkyraelseqdifvipagypvvvna
    tsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesyf
    vda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uikC (C:)
    rrhknknpfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlll
    phhadadylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmi
    tlaipvnkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgreegqqqg
    eerlqesviveiskkqirelskhaksssrktissedkpfnlrsrdpiysnklgklfeitp
    eknpqlrdldvflsvvdmnegalflphfnskaivvlvinegeanielvgikeqqqrqqqe
    eqplevrkyraelseqdifvipagypvvvnatsdlnffafginaennqrnflagskdnvi
    sqipsqvqelafpgsakdienliksqsesyfvdaqpqqkeegnkgrkgplssilrafy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uikC (C:)
    npfhfnskrfqtlfknqyghvrvlqrfnkrsqqlqnlrdyrilefnskpntlllphhada
    dylivilngtailtlvnnddrdsynlqsgdalrvpagttyyvvnpdndenlrmitlaipv
    nkpgrfesfflsstqaqqsylqgfsknileasydtkfeeinkvlfgqesviveiskkqir
    elskhaksssrktissedkpfnlrsrdpiysnklgklfeitpeknpqlrdldvflsvvdm
    negalflphfnskaivvlvinegeanielvgiplevrkyraelseqdifvipagypvvvn
    atsdlnffafginaennqrnflagskdnvisqipsqvqelafpgsakdienliksqsesy
    fvda