PDB entry 1uij

View 1uij on RCSB PDB site
Description: Crystal Structure Of Soybean beta-Conglycinin Beta Homotrimer (I122M/K124W)
Deposited on 2003-07-16, released 2004-07-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-16, with a file datestamp of 2004-07-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uijA (A:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijA (A:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeqrqq
    egvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpq
    lrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsedd
    vfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaq
    dverllkkqresyfvda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uijB (B:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijB (B:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivel
    skeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldif
    lssvdinegalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaa
    ypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllk
    kqresyfvda
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uijC (C:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijC (C:)
    dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
    hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
    aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivelde
    pfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalllphfnskaivilv
    inegdanielvgikplevqryraelseddvfvipaaypfvvnatsnlnflafginaennq
    rnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1uijD (D:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijD (D:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeqrqq
    egvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpq
    lrdldiflssvdinegalllphfnskaivilvinegdanielvgiklevqryraelsedd
    vfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaq
    dverllkkqresyfvda
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1uijE (E:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijE (E:)
    redennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntill
    phhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmi
    wlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivel
    skeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpeknpqlrdldif
    lssvdinegalllphfnskaivilvinegdanielvgiklevqryraelseddvfvipaa
    ypfvvnatsnlnflafginaennqrnflagekdnvvrqierqvqelafpgsaqdverllk
    kqresyfvda
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1uijF (F:)
    lkvredennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpnt
    illphhadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnl
    kmiwlaipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgeeeeq
    rqqegvivelskeqirqlsrraksssrktissedepfnlrsrnpiysnnfgkffeitpek
    npqlrdldiflssvdinegalllphfnskaivilvinegdanielvgikeqqqkqkqeee
    plevqryraelseddvfvipaaypfvvnatsnlnflafginaennqrnflagekdnvvrq
    ierqvqelafpgsaqdverllkkqresyfvdaqpqqkeegskgrkgpfpsilgaly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uijF (F:)
    dennpfyfrssnsfqtlfenqngrirllqrfnkrspqlenlrdyrivqfqskpntillph
    hadadfllfvlsgrailtlvnnddrdsynlhpgdaqripagttyylvnphdhqnlkmiwl
    aipvnkpgryddfflsstqaqqsylqgfshniletsfhsefeeinrvlfgqegvivelde
    pfnlrsrnpiysnnfgkffeitpeknpqlrdldiflssvdinegalllphfnskaivilv
    inegdanielvgikplevqryraelseddvfvipaaypfvvnatsnlnflafginaennq
    rnflagekdnvvrqierqvqelafpgsaqdverllkkqresyfvda