PDB entry 1uii

View 1uii on RCSB PDB site
Description: Crystal structure of Geminin coiled-coil domain
Deposited on 2003-07-16, released 2004-07-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-16, with a file datestamp of 2004-07-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uiia_
  • Chain 'B':
    Domains in SCOP 1.69: d1uiib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uiiA (A:)
    pessenknlggvtqesfdlmikenpssqywkevaekrrkalyealkeneklhkeieqkdn
    eiarlkkenkelaevaehvqyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiiA (A:)
    enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uiiB (B:)
    pessenknlggvtqesfdlmikenpssqywkevaekrrkalyealkeneklhkeieqkdn
    eiarlkkenkelaevaehvqyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiiB (B:)
    enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
    a