PDB entry 1ui9

View 1ui9 on RCSB PDB site
Description: Crystal analysis of chorismate mutase from thermus thermophilus
Class: isomerase
Keywords: CHORISMATE MUTASE, SHIKIMATE PATHWAY, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ISOMERASE
Deposited on 2003-07-15, released 2003-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.204
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84FH6 (0-End)
      • conflict (54)
    Domains in SCOPe 2.08: d1ui9a_
  • Heterogens: MES, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ui9A (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrpdles
    aq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui9A (A:)
    mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpae
    aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp