PDB entry 1ui5

View 1ui5 on RCSB PDB site
Description: Crystal structure of gamma-butyrolactone receptor (ArpA like protein)
Deposited on 2003-07-15, released 2004-07-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ui5A (A:)
    marqlraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahai
    leiqsrtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrppl
    phpftewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprr
    laemwyilirgmvpvtrraryvtlaarleqetgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui5A (A:)
    lraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahaileiq
    srtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrplphpft
    ewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvreprrlaemwyilirgmv
    pvtrraryvtlaarleqet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ui5B (B:)
    marqlraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahai
    leiqsrtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrppl
    phpftewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprr
    laemwyilirgmvpvtrraryvtlaarleqetgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui5B (B:)
    lraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahaileiq
    srtsrrlakdlysslealmrltfgmarlcvqgpvlraglrlatagvpvrlphpftewrei
    atsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilir
    gmvpvtrraryvtlaarleqetg