PDB entry 1ui5

View 1ui5 on RCSB PDB site
Description: Crystal structure of gamma-butyrolactone receptor (ArpA like protein)
Class: antibiotic
Keywords: helix-turn-helix, alpha-helix-bundle, ANTIBIOTIC
Deposited on 2003-07-15, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A-factor receptor homolog
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66122
      • modified residue (86)
      • modified residue (92)
      • modified residue (183)
      • modified residue (191)
    Domains in SCOPe 2.07: d1ui5a1, d1ui5a2
  • Chain 'B':
    Compound: A-factor receptor homolog
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66122
      • modified residue (86)
      • modified residue (92)
      • modified residue (183)
      • modified residue (191)
    Domains in SCOPe 2.07: d1ui5b1, d1ui5b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ui5A (A:)
    marqlraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahai
    leiqsrtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrppl
    phpftewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprr
    laemwyilirgmvpvtrraryvtlaarleqetgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui5A (A:)
    lraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahaileiq
    srtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrplphpft
    ewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvreprrlaemwyilirgmv
    pvtrraryvtlaarleqet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ui5B (B:)
    marqlraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahai
    leiqsrtsrrlakdldgrgysslealmrltfgmarlcvqgpvlraglrlatagvpvrppl
    phpftewreiatsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprr
    laemwyilirgmvpvtrraryvtlaarleqetgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui5B (B:)
    lraeqtratiigaaadlfdrrgyesttlseivahagvtkgalyfhfaakedlahaileiq
    srtsrrlakdlysslealmrltfgmarlcvqgpvlraglrlatagvpvrlphpftewrei
    atsrlldavrqsdvhqdidvdsvahtlvcsvvgtrvvggtlepagreprrlaemwyilir
    gmvpvtrraryvtlaarleqetg