PDB entry 1ui1

View 1ui1 on RCSB PDB site
Description: Crystal Structure Of Uracil-DNA Glycosylase From Thermus Thermophilus HB8
Class: hydrolase
Keywords: Base Excision Repair, Uracil-DNA Glycosylase, Iron/Sulfer Cluster, Thermophile, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, HYDROLASE
Deposited on 2003-07-14, released 2003-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.214
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Thermus thermophilus [TaxId:274]
    Gene: tthudg
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYV4
      • modified residue (18)
      • modified residue (36)
      • modified residue (152)
    Domains in SCOPe 2.07: d1ui1a_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ui1A (A:)
    mtlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagq
    llnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivpl
    gavaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqe
    vkraldalppkerrpvkavsqeplf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ui1A (A:)
    tlellqaqaqnctacrlmegrtrvvfgegnpdaklmivgegpgeeedktgrpfvgkagql
    lnrileaagipreevyitnivkcrppqnraplpdeakictdkwllkqieliapqiivplg
    avaaefflgekvsitkvrgkwyewhgikvfpmfhpayllrnpsrapgspkhltwldiqev
    kraldalp