PDB entry 1uhz

View 1uhz on RCSB PDB site
Description: Solution structure of dsRNA binding domain in Staufen homolog 2
Class: RNA binding protein
Keywords: NMR, dsrm, Staufen homolog 2, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2003-07-14, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staufen (RNA binding protein) homolog 2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8CJ67 (7-82)
      • cloning artifact (0-6)
      • cloning artifact (83-88)
    Domains in SCOPe 2.07: d1uhza1, d1uhza2, d1uhza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhzA (A:)
    gssgssgpisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkki
    akknaaeamllqlgykastslqdsgpssg