PDB entry 1uhz

View 1uhz on RCSB PDB site
Description: solution structure of dsrna binding domain in staufen homolog 2
Deposited on 2003-07-14, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1uhza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhzA (A:)
    gssgssgpisrlaqiqqarkekepdyillsergmprrrefvmqvkvgnevatgtgpnkki
    akknaaeamllqlgykastslqdsgpssg