PDB entry 1uhw

View 1uhw on RCSB PDB site
Description: Solution structure of the DEP domain of mouse pleckstrin
Class: signaling protein
Keywords: THREE-HELIX BUNDLE, BETA-ARM, PLECKSTRIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, SIGNALING PROTEIN
Deposited on 2003-07-11, released 2004-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pleckstrin
  Species: Mus musculus [TaxId:10090]
  Gene: RIKEN cDNA 1810074L23
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JHK5 (7-102)
    • cloning artifact (0-6)
    • cloning artifact (103-108)
  Domains in SCOPe 2.05: d1uhwa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhwA (A:)
  gssgssglgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqegl
  misasllsegylqpagdlsknaadgiaenpfldspdafyyfpdsgpssg