PDB entry 1uhw

View 1uhw on RCSB PDB site
Description: Solution structure of the DEP domain of mouse pleckstrin
Class: signaling protein
Keywords: THREE-HELIX BUNDLE, BETA-ARM, PLECKSTRIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, SIGNALING PROTEIN
Deposited on 2003-07-11, released 2004-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pleckstrin
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1810074L23
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JHK5 (7-102)
      • cloning artifact (0-6)
      • cloning artifact (103-108)
    Domains in SCOPe 2.08: d1uhwa1, d1uhwa2, d1uhwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhwA (A:)
    gssgssglgalylsmkdpekgikelnlekdkkvfnhcltgsgvidwlvsnklvrnrqegl
    misasllsegylqpagdlsknaadgiaenpfldspdafyyfpdsgpssg