PDB entry 1uhv

View 1uhv on RCSB PDB site
Description: Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
Class: hydrolase
Keywords: family 39 glycoside hydrolase, xylosidase, xylan, xylose, covalent glycosyl-enzyme intermediate
Deposited on 2003-07-11, released 2003-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1uhva1, d1uhva2
  • Chain 'B':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1uhvb1, d1uhvb2
  • Chain 'C':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1uhvc1, d1uhvc2
  • Chain 'D':
    Compound: beta-xylosidase
    Species: Thermoanaerobacterium saccharolyticum [TaxId:28896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36906 (0-499)
      • see remark 999 (229)
    Domains in SCOPe 2.07: d1uhvd1, d1uhvd2
  • Heterogens: DFX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvA (A:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvB (B:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvC (C:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhvD (D:)
    mikvrvpdfsdkkfsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcdd
    vgiyredvvgdevkpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegn
    vtppkdyekwsdlvkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklyk
    vtakaikevnenlkvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytph
    liyqeimpseymlnefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiar
    ilseggdyvdsfsywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamgee
    mlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrfrdvfikrqlideehg
    npwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnlkfklgknavvlyelt
    eridesstyiglddskingy