PDB entry 1uhu

View 1uhu on RCSB PDB site
Description: Solution structure of the retroviral Gag MA-like domain of RIKEN cDNA 3110009E22
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-07-10, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: product of RIKEN cDNA 3110009E22
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UHU (0-104)
    Domains in SCOPe 2.08: d1uhua1, d1uhua2, d1uhua3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhuA (A:)
    gssgssgtplsltldhwseirsrahnlsveikkgpwrtfcasewptfdvgwppegtfdlt
    vifevkaivfqdgpgshpdqqpyitvwqdlvqnsppwiksgpssg