PDB entry 1uht

View 1uht on RCSB PDB site
Description: Solution Structure of The FHA Domain of Arabidopsis thaliana Hypothetical Protein
Class: structural genomics, unknown function
Keywords: FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-07-10, released 2004-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: expressed protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RIKEN cDNA RAFL09-79-A12
    Database cross-references and differences (RAF-indexed):
    • Uniprot O23305 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOPe 2.07: d1uhta1, d1uhta2, d1uhta3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhtA (A:)
    gssgssgmvtpslrlvfvkgpregdaldykpgstirvgrivrgneiaikdagistkhlri
    esdsgnwviqdlgssngtllnsnaldpetsvnlgdgdviklgeytsilvnfvsgpssg