PDB entry 1uhs

View 1uhs on RCSB PDB site
Description: Solution structure of mouse homeodomain-only protein HOP
Class: transcription
Keywords: Structural genomics, Cardiac development, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2003-07-10, released 2004-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homeodomain only protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1110018K11
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8R1H0 (8-71)
      • cloning artifact (0-7)
    Domains in SCOPe 2.08: d1uhsa1, d1uhsa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhsA (A:)
    gsegaatmtedqveileynfnkvnkhpdpttlcliaaeaglteeqtqkwfkqrlaewrrs
    eglpsecrsvtd