PDB entry 1uhr

View 1uhr on RCSB PDB site
Description: Solution structure of the SWIB domain of mouse BRG1-associated factor 60a
Class: gene regulation
Keywords: structural genomics, SWI/SNF, Chromatin remodeling, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2003-07-09, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily D member 1
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 0710008A09
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61466 (7-86)
      • cloning artifact (0-6)
      • cloning artifact (87-92)
    Domains in SCOPe 2.08: d1uhra1, d1uhra2, d1uhra3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uhrA (A:)
gssgssgqppqfkldprlarllgihtqtrpviiqalwqyikthklqdpherefvlcdkyl
qqifesqrmkfseipqrlhallmppepsgpssg