PDB entry 1uhq

View 1uhq on RCSB PDB site
Description: human renin complexed with a substituted piperidine
Deposited on 2003-07-09, released 2003-07-22
Made obsolete on 2003-08-18

The last revision prior to the SCOP 1.73 freeze date was dated 2003-07-22, with a file datestamp of 2003-07-22.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.187
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.73: d1uhqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhqA (A:)
    ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
    hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
    laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
    sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
    klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
    hamdippptgptwalgatfirkfytefdrrnnrigfalar