PDB entry 1uhp

View 1uhp on RCSB PDB site
Description: Solution structure of RSGI RUH-005, a PDZ domain in human cDNA, KIAA1095
Deposited on 2003-07-09, released 2004-01-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-09, with a file datestamp of 2004-01-09.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uhpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhpA (A:)
    gssgssgksltlvlhrdsgslgfniiggrpsvdnhdgsssegifvskivdsgpaakeggl
    qihdriievngrdlsrathdqaveafktakepivvqvlrrtsgpssg