PDB entry 1uho

View 1uho on RCSB PDB site
Description: Crystal structure of Human Phosphodiesterase 5 complexed with Vardenafil(Levitra)
Deposited on 2003-07-09, released 2004-07-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-09, with a file datestamp of 2004-07-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1uhoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uhoA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlkii
    kqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqq
    riaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvs
    edcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhoA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsyychsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlal
    yikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateff
    dqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealthvsedcfplldgcr
    knrqkwqalaeqq