PDB entry 1uhn

View 1uhn on RCSB PDB site
Description: The crystal structure of the calcium binding protein AtCBL2 from Arabidopsis thaliana
Deposited on 2003-07-07, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uhna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uhnA (A:)
dpellardtvfsvseiealyelfkkissaviddglinkeefqlalfktnkkeslfadrvf
dlfdtkhngilgfeefaralsvfhpnapiddkihfsfqlydlkqqgfierqevkqmvvat
laesgmnlkdtviediidktfeeadtkhdgkidkeewrslvlrhpsllknmtlqylkdit
ttfpsfvfh