PDB entry 1uhm

View 1uhm on RCSB PDB site
Description: solution structure of the globular domain of linker histone homolog hho1p from s. cerevisiae
Deposited on 2003-07-05, released 2003-12-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-16, with a file datestamp of 2003-12-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1uhma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhmA (A:)
  eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgvea
  gdfeqpkgpagavklakk