PDB entry 1uhm

View 1uhm on RCSB PDB site
Description: Solution structure of the globular domain of linker histone homolog Hho1p from S. cerevisiae
Class: structural protein
Keywords: winged helix-turn-helix, linker histone, S. cerevisiae, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, STRUCTURAL PROTEIN
Deposited on 2003-07-05, released 2003-12-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: HHO1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uhma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhmA (A:)
    eassksyreliiegltalkerkgssrpalkkfikenypivgsasnfdlyfnnaikkgvea
    gdfeqpkgpagavklakk