PDB entry 1uhi

View 1uhi on RCSB PDB site
Description: Crystal structure of i-aequorin
Class: luminescent protein
Keywords: 4 EF-hand motif, Complex, LUMINESCENT PROTEIN
Deposited on 2003-07-03, released 2005-02-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aequorin 2
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02592 (3-190)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1uhia2, d1uhia3
  • Chain 'B':
    Compound: Aequorin 2
    Species: Aequorea victoria [TaxId:6100]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uhib_
  • Heterogens: CZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhiA (A:)
    anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
    kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
    dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
    aceklyggavp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uhiB (B:)
    anskltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrh
    kdaveaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdk
    dqngaitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdp
    aceklyggavp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhiB (B:)
    ltsdfdnprwigrhkhmfnfldvnhngkisldemvykasdivinnlgatpeqakrhkdav
    eaffggagmkygvetdwpayiegwkklatdelekyakneptliriwgdalfdivdkdqng
    aitldewkaytkaagiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpacek
    lyggavp