PDB entry 1uhg

View 1uhg on RCSB PDB site
Description: Crystal Structure of S-Ovalbumin At 1.9 Angstrom Resolution
Class: allergen
Keywords: Allergen, egg white protein, serpin
Deposited on 2003-07-03, released 2003-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-384)
      • modified residue (67)
      • modified residue (163)
      • modified residue (235)
      • modified residue (319)
      • modified residue (343)
    Domains in SCOPe 2.07: d1uhga_
  • Chain 'B':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-384)
      • modified residue (67)
      • modified residue (163)
      • modified residue (235)
      • modified residue (319)
      • modified residue (343)
    Domains in SCOPe 2.07: d1uhgb_
  • Chain 'C':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-384)
      • modified residue (67)
      • modified residue (163)
      • modified residue (235)
      • modified residue (319)
    Domains in SCOPe 2.07: d1uhgc_
  • Chain 'D':
    Compound: Ovalbumin
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-384)
      • modified residue (67)
      • modified residue (163)
      • modified residue (235)
      • modified residue (319)
      • modified residue (343)
    Domains in SCOPe 2.07: d1uhgd_
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uhgA (A:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
    mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
    gitdvfsssanlsgissaeslkisqavhaahaeineagrevvgsaeagvdaasvseefra
    dhpflfcikhiatnavlffgrcvsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhgA (A:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteskpvqmmyqiglfrvasmasekmkilelpfasgtmsml
    vllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmamgi
    tdvfsssanlsgissaeslkisqavhaahaeineagrevvgsaeagvdaasvseefradh
    pflfcikhiatnavlffgrcvsp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhgB (B:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
    mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
    gitdvfsssanlsgissaeslkisqavhaahaeineagrevvgsaeagvdaasvseefra
    dhpflfcikhiatnavlffgrcvsp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uhgC (C:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
    mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
    gitdvfsssanlsgissaeslkisqavhaahaeineagrevvgsaeagvdaasvseefra
    dhpflfcikhiatnavlffgrcvsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uhgC (C:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
    mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
    gitdvfsssanlsgissaeslkisqavhaahaeineagrevvvseefradhpflfcikhi
    atnavlffgrcvsp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhgD (D:)
    gsigaasmefcfdvfkelkvhhanenifycpiaimsalamvylgakdstrtqinkvvrfd
    klpgfgdsieaqcgtsvnvhsslrdilnqitkpndvysfslasrlyaeerypilpeylqc
    vkelyrgglepinfqtaadqarelinswvesqtngiirnvlqpssvdsqtamvlvnaivf
    kglwekafkdedtqampfrvteqeskpvqmmyqiglfrvasmasekmkilelpfasgtms
    mlvllpdevsgleqlesiinfekltewtssnvmeerkikvylprmkmeekynltsvlmam
    gitdvfsssanlsgissaeslkisqavhaahaeineagrevvgsaeagvdaasvseefra
    dhpflfcikhiatnavlffgrcvsp