PDB entry 1uhf

View 1uhf on RCSB PDB site
Description: Solution Structure of the third SH3 domain of human intersectin 2(KIAA1256)
Class: signaling protein
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, SIGNALING PROTEIN
Deposited on 2003-07-03, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Intersectin 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9NZM3 (7-62)
    • cloning artifact (0-6)
    • cloning artifact (63-68)
  Domains in SCOPe 2.07: d1uhfa1, d1uhfa2, d1uhfa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uhfA (A:)
  gssgssggeeyialypyssvepgdltftegeeilvtqkdgewwtgsigdrsgifpsnyvk
  pkdsgpssg